Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 11B1, mitochondrial
LigandBDBM50395455
Substrate/Competitorn/a
Meas. Tech.ChEMBL_935760
IC50 2.2±n/a nM
Citation Yin LHu QHartmann RW Tetrahydropyrroloquinolinone type dual inhibitors of aromatase/aldosterone synthase as a novel strategy for breast cancer patients with elevated cardiovascular risks. J Med Chem 56:460-70 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 11B1, mitochondrial
Name:Cytochrome P450 11B1
Synonyms:CYPXIB1 | Cytochrome P450 11B, mitochondrial precursor | Cytochrome P450 11B1 | Cytochrome P450 11B1 (CYP11B1)
Type:Enzyme
Mol. Mass.:57591.44
Organism:Homo sapiens (Human)
Description:P15538
Residue:503
Sequence:
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQG
YEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELS
PDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSMFPLLTFRAIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395455
n/a
NameBDBM50395455
Synonyms:CHEMBL2163639
TypeSmall organic molecule
Emp. Form.C18H19N3O
Mol. Mass.293.363
SMILESO=C1CCc2cc(cc3CCN1c23)C(C1CC1)n1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: