| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Casein kinase I isoform alpha |
|---|
| Ligand | BDBM7401 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_939731 (CHEMBL2329084) |
|---|
| IC50 | 1200±n/a nM |
|---|
| Citation |  Myrianthopoulos, V; Kritsanida, M; Gaboriaud-Kolar, N; Magiatis, P; Ferandin, Y; Durieu, E; Lozach, O; Cappel, D; Soundararajan, M; Filippakopoulos, P; Sherman, W; Knapp, S; Meijer, L; Mikros, E; Skaltsounis, AL Novel Inverse Binding Mode of Indirubin Derivatives Yields Improved Selectivity for DYRK Kinases. ACS Med Chem Lett4:22-26 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Casein kinase I isoform alpha |
|---|
| Name: | Casein kinase I isoform alpha |
|---|
| Synonyms: | CK1 | CKI-alpha | CSNK1A1 | KC1A_PIG |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14639.55 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_939731 |
|---|
| Residue: | 125 |
|---|
| Sequence: | GEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLED
LFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFG
LAKKY
|
|
|
|---|
| BDBM7401 |
|---|
| n/a |
|---|
| Name | BDBM7401 |
|---|
| Synonyms: | (2 Z,3 E)-6-Bromoindirubin-3 -oxime | (3E)-6-bromo-3-[3-(hydroxyamino)indol-2-ylidene]oxindole | 6-bromo-3-[(2Z,3E)-3-(hydroxyimino)-2,3-dihydro-1H-indol-2-ylidene]-2,3-dihydro-1H-indol-2-one | 6-bromoindirubin-3 -oxime | 6BIO | CHEMBL409450 | indirubin deriv. 7a |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H10BrN3O2 |
|---|
| Mol. Mass. | 356.174 |
|---|
| SMILES | Brc1ccc2C(C(=O)Nc2c1)c1[nH]c2ccccc2c1N=O |
|---|
| Structure | 
|
|---|
Search and Browse
