BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine--oxoglutarate transaminase 3
LigandBDBM50426341
Substrate/Competitorn/a
Meas. Tech.ChEMBL_939752
IC50 1230±n/a nM
Citation Tuttle JBAnderson MBechle BMCampbell BMChang CDounay ABEvrard EFonseca KRGan XGhosh SHorner WJames LCKim JYMcAllister LAPandit JParikh VDRago BJSalafia MAStrick CAZawadzke LEVerhoest PR Structure-Based Design of Irreversible Human KAT II Inhibitors: Discovery of New Potency-Enhancing Interactions. ACS Med Chem Lett 4:37-40 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine--oxoglutarate transaminase 3
Name:Kynurenine--oxoglutarate transaminase 3
Synonyms:CCBL2 | Cysteine-S-conjugate beta-lyase 2 | KAT3 | KATIII | Kynurenine aminotransferase III | Kynurenine--glyoxylate transaminase | Kynurenine--oxoglutarate transaminase III
Type:PROTEIN
Mol. Mass.:51406.81
Organism:Homo sapiens (Human)
Description:ChEMBL_939752
Residue:454
Sequence:
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426341
n/a
NameBDBM50426341
Synonyms:CHEMBL2321944
TypeSmall organic molecule
Emp. Form.C15H14N2O3
Mol. Mass.270.2833
SMILESN[C@H]1Cc2cc(Oc3ccccc3)ccc2N(O)C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: