Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent dopamine transporter
LigandBDBM50426351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_939923
Ki 6.0±n/a nM
Citation Brown DGBernstein PRWu YUrbanek RABecker CWThroner SRDembofsky BTSteelman GBLazor LAScott CWWood MWWesolowski SSNugiel DAKoch SYu JPivonka DELi SThompson CZacco AElmore CSSchroeder PLiu JHurley CAWard SHunt HJWilliams KMcLaughlin JHoesch VSydserff SMaier DAharony D Azepines and piperidines with dual norepinephrine dopamine uptake inhibition and antidepressant activity. ACS Med Chem Lett 4:46-51 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent dopamine transporter
Name:Sodium-dependent dopamine transporter
Synonyms:DA transporter | DAT | DAT1 | Dopamine transporter (DAT) | Dopamine transporter protein (DAT) | SLC6A3 | Sodium-dependent dopamine transporter (DAT) | Solute carrier family 6 member 3
Type:Multi-pass membrane protein
Mol. Mass.:68497.11
Organism:Homo sapiens (Human)
Description:Q01959
Residue:620
Sequence:
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426351
n/a
NameBDBM50426351
Synonyms:CHEMBL2321999
TypeSmall organic molecule
Emp. Form.C12H13Cl2N
Mol. Mass.242.144
SMILESClc1ccc(cc1Cl)[C@@H]1CNCC=CC1 |r,c:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: