Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen synthase kinase-3 beta
LigandBDBM50426461
Substrate/Competitorn/a
Meas. Tech.ChEMBL_940354
Ki 58±n/a nM
Citation Tong YStewart KDFlorjancic ASHarlan JEMerta PJPrzytulinska MSoni NSwinger KKZhu HJohnson EFShoemaker ARPenning TD Azaindole-Based Inhibitors of Cdc7 Kinase: Impact of the Pre-DFG Residue, Val 195. ACS Med Chem Lett 4:211-5 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycogen synthase kinase-3 beta
Name:Glycogen synthase kinase-3 beta
Synonyms:GSK-3 beta | GSK-3, beta | Glycogen synthase kinase 3 beta (GSK3B) | Glycogen synthase kinase 3-beta (GSK3B) | Glycogen synthase kinase-3 beta (GSK-3B) | Glycogen synthase kinase-3 beta (GSK3 Beta) | Glycogen synthase kinase-3 beta (GSK3B) | Glycogen synthase kinase-3B (GSK-3B) | Glycogen synthase kinase-3beta (GSK3B) | Serine/threonine-protein kinase GSK3B
Type:Enzyme
Mol. Mass.:46756.38
Organism:Homo sapiens (Human)
Description:P49841
Residue:420
Sequence:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426461
n/a
NameBDBM50426461
Synonyms:CHEMBL2322677
TypeSmall organic molecule
Emp. Form.C18H19ClN4
Mol. Mass.326.823
SMILESClc1cc(cc(NC2CCCCC2)n1)-c1c[nH]c2ncccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: