Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDC7/DBF4 (Cell division cycle 7-related protein kinase/Activator of S phase kinase)
LigandBDBM50365695
Substrate/Competitorn/a
Meas. Tech.ChEMBL_940355
Ki 0.280000±n/a nM
Citation Tong YStewart KDFlorjancic ASHarlan JEMerta PJPrzytulinska MSoni NSwinger KKZhu HJohnson EFShoemaker ARPenning TD Azaindole-Based Inhibitors of Cdc7 Kinase: Impact of the Pre-DFG Residue, Val 195. ACS Med Chem Lett 4:211-5 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CDC7/DBF4 (Cell division cycle 7-related protein kinase/Activator of S phase kinase)
Name:Cell division cycle 7-related protein kinase
Synonyms:Cell division cycle 7-related protein kinase | Cell division cycle 7-related protein kinase (CDC7)
Type:Protein
Mol. Mass.:63908.16
Organism:Homo sapiens (Human)
Description:O00311
Residue:574
Sequence:
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50365695
n/a
NameBDBM50365695
Synonyms:CHEMBL1958408
TypeSmall organic molecule
Emp. Form.C18H20N4O
Mol. Mass.308.3776
SMILESO=c1cc(cc(NC2CCCCC2)[nH]1)-c1c[nH]c2ncccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: