Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKCNQ (Kv7) potassium channel
LigandBDBM50426567
Substrate/Competitorn/a
Meas. Tech.ChEMBL_938652
EC50 2400±n/a nM
Citation Bagal SKBrown ADCox PJOmoto KOwen RMPryde DCSidders BSkerratt SEStevens EBStorer RISwain NA Ion channels as therapeutic targets: a drug discovery perspective. J Med Chem 56:593-624 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
KCNQ (Kv7) potassium channel
Name:KCNQ (Kv7) potassium channel
Synonyms:Voltage-gated potassium channel subunit Kv7.3
Type:PROTEIN
Mol. Mass.:96759.41
Organism:Homo sapiens (Human)
Description:ChEMBL_938652
Residue:872
Sequence:
MGLKARRAAGAAGGGGDGGGGGGGAANPAGGDAAAAGDEERKVGLAPGDVEQVTLALGAG
ADKDGTLLLEGGGRDEGQRRTPQGIGLLAKTPLSRPVKRNNAKYRRIQTLIYDALERPRG
WALLYHALVFLIVLGCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGC
CCRYKGWRGRLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRM
DRRGGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEF
ETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQ
EQHRQKHFEKRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFRKEQLEAAS
SQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKA
YAFWQSSEDAGTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRP
YDVKDVIEQYSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTFPSQQSPR
NEPYVARPSTSEIEDQSMMGKFVKVERQVQDMGKKLDFLVDMHMQHMERLQVQVTEYYPT
KGTSSPAEAEKKEDNRYSDLKTIICNYSETGPPEPPYSFHQVTIDKVSPYGFFAHDPVNL
PRGGPSSGKVQATPPSSATTYVERPTVLPILTLLDSRVSCHSQADLQGPYSDRISPRQRR
SITRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYVFGPNGGSSWMREKRYLAEGETDT
DTDPFTPSGSMPLSSTGDGISDSVWTPSNKPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426567
n/a
NameBDBM50426567
Synonyms:BMS-204352 | FLINDOKALNER | MaxiPost
TypeSmall organic molecule
Emp. Form.C16H10ClF4NO2
Mol. Mass.359.703
SMILESCOc1ccc(Cl)cc1[C@]1(F)C(=O)Nc2cc(ccc12)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: