Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 12
LigandBDBM50426822
Substrate/Competitorn/a
Meas. Tech.ChEMBL_938159
Ki 14600±n/a nM
Citation Bozdag MDreker THenry CTosco PVallaro MFruttero RScozzafava ACarta FSupuran CT Novel small molecule protein arginine deiminase 4 (PAD4) inhibitors. Bioorg Med Chem Lett 23:715-9 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 12
Name:Carbonic anhydrase
Synonyms:CA-XII | Carbonate dehydratase XII | Carbonic anhydrase 12 (CA XII) | Carbonic anhydrase XII (CA XII) | Carbonic anhydrase XII (CAXII) | Tumor antigen HOM-RCC-3.1.3
Type:Enzyme
Mol. Mass.:39456.00
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:354
Sequence:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426822
n/a
NameBDBM50426822
Synonyms:1-(4-Hydroxyphenyl)Guanidine Hydrochloride | CHEMBL2323124
TypeSmall organic molecule
Emp. Form.C7H9N3O
Mol. Mass.151.1659
SMILES[#7]\[#6](-[#7])=[#7]\c1ccc(-[#8])cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: