Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine racemase
LigandBDBM31147
Substrate/Competitorn/a
Meas. Tech.ChEMBL_938786
IC50>100000±n/a nM
Citation Katane MOsaka NMatsuda SMaeda KKawata TSaitoh YSekine MFuruchi TDoi IHirono SHomma H Identification of novel D-amino acid oxidase inhibitors by in silico screening and their functional characterization in vitro. J Med Chem 56:1894-907 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine racemase
Name:Serine racemase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36565.80
Organism:Homo sapiens (Human)
Description:ChEMBL_1516972
Residue:340
Sequence:
MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGA
LNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQA
YGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDAL
VVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGV
KSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQT
VSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31147
n/a
NameBDBM31147
Synonyms:4H-furo[3,2-b]pyrrole-5-carboxylic acid | 5-carboxyfuro[3,2-b]pyrrole, 1 | CHEMBL492591
TypeSmall organic molecule
Emp. Form.C7H5NO3
Mol. Mass.151.1195
SMILESOC(=O)c1cc2occc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: