Reaction Details |
| Report a problem with these data |
Target | Steroid Delta-isomerase |
---|
Ligand | BDBM50427552 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_941591 (CHEMBL2330673) |
---|
Kd | 63000±n/a nM |
---|
Citation | Kobe, A; Caaveiro, JM; Tashiro, S; Kajihara, D; Kikkawa, M; Mitani, T; Tsumoto, K Incorporation of rapid thermodynamic data in fragment-based drug discovery. J Med Chem56:2155-9 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Steroid Delta-isomerase |
---|
Name: | Steroid Delta-isomerase |
Synonyms: | Delta(5)-3-ketosteroid isomerase | SDIS_PSEPU | ksi |
Type: | PROTEIN |
Mol. Mass.: | 14529.85 |
Organism: | Pseudomonas putida |
Description: | ChEMBL_941591 |
Residue: | 131 |
Sequence: | MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQG
LGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYW
SEVNLSVREPQ
|
|
|
BDBM50427552 |
---|
n/a |
---|
Name | BDBM50427552 |
Synonyms: | CHEMBL382602 |
Type | Small organic molecule |
Emp. Form. | C10H10N2O |
Mol. Mass. | 174.1992 |
SMILES | Cn1cc(C(N)=O)c2ccccc12 |
Structure |
|