Reaction Details |
| Report a problem with these data |
Target | Steroid Delta-isomerase |
---|
Ligand | BDBM50292538 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_941591 (CHEMBL2330673) |
---|
Kd | 180000±n/a nM |
---|
Citation | Kobe, A; Caaveiro, JM; Tashiro, S; Kajihara, D; Kikkawa, M; Mitani, T; Tsumoto, K Incorporation of rapid thermodynamic data in fragment-based drug discovery. J Med Chem56:2155-9 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Steroid Delta-isomerase |
---|
Name: | Steroid Delta-isomerase |
Synonyms: | Delta(5)-3-ketosteroid isomerase | SDIS_PSEPU | ksi |
Type: | PROTEIN |
Mol. Mass.: | 14529.85 |
Organism: | Pseudomonas putida |
Description: | ChEMBL_941591 |
Residue: | 131 |
Sequence: | MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQG
LGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYW
SEVNLSVREPQ
|
|
|
BDBM50292538 |
---|
n/a |
---|
Name | BDBM50292538 |
Synonyms: | (3aS,8aR)-1,3a,8-trimethyl-1,2,3,3a,8,8a-hexahydropyrrolo[2,3-b]indol-5-ol | CHEMBL310934 | eseroline |
Type | Small organic molecule |
Emp. Form. | C13H18N2O |
Mol. Mass. | 218.2948 |
SMILES | CN1CC[C@]2(C)[C@H]1N(C)c1ccc(O)cc21 |r| |
Structure |
|