| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Steroid Delta-isomerase |
|---|
| Ligand | BDBM50375599 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_941591 (CHEMBL2330673) |
|---|
| Kd | 16000±n/a nM |
|---|
| Citation |  Kobe, A; Caaveiro, JM; Tashiro, S; Kajihara, D; Kikkawa, M; Mitani, T; Tsumoto, K Incorporation of rapid thermodynamic data in fragment-based drug discovery. J Med Chem56:2155-9 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Steroid Delta-isomerase |
|---|
| Name: | Steroid Delta-isomerase |
|---|
| Synonyms: | Delta(5)-3-ketosteroid isomerase | SDIS_PSEPU | ksi |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14529.85 |
|---|
| Organism: | Pseudomonas putida |
|---|
| Description: | ChEMBL_941591 |
|---|
| Residue: | 131 |
|---|
| Sequence: | MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQG
LGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYW
SEVNLSVREPQ
|
|
|
|---|
| BDBM50375599 |
|---|
| n/a |
|---|
| Name | BDBM50375599 |
|---|
| Synonyms: | DEOXYCHOLATE | Deoxycholic Acid | KYBELLA |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H40O4 |
|---|
| Mol. Mass. | 392.572 |
|---|
| SMILES | C[C@H](CCC(O)=O)[C@H]1CC[C@H]2[C@@H]3CC[C@@H]4C[C@H](O)CC[C@]4(C)[C@H]3C[C@H](O)[C@]12C |
|---|
| Structure | 
|
|---|
Search and Browse
