Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
LigandBDBM50427619
Substrate/Competitorn/a
Meas. Tech.ChEMBL_941824
IC50 340±n/a nM
Citation Liedtke AJAdeniji AOChen MByrns MCJin YChristianson DWMarnett LJPenning TM Development of potent and selective indomethacin analogues for the inhibition of AKR1C3 (Type 5 17ß-hydroxysteroid dehydrogenase/prostaglandin F synthase) in castrate-resistant prostate cancer. J Med Chem 56:2429-46 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
Name:Aldo-keto-reductase family 1 member C3
Synonyms:3-alpha-HSD type 2 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
Type:Enzyme
Mol. Mass.:36859.86
Organism:Homo sapiens (Human)
Description:P42330
Residue:323
Sequence:
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50427619
n/a
NameBDBM50427619
Synonyms:CHEMBL2323511 | US9346803, 3
TypeSmall organic molecule
Emp. Form.C21H21ClN2O5S
Mol. Mass.448.92
SMILESCOc1ccc2n(C(=O)c3ccc(Cl)cc3)c(CCC(=O)NS(C)(=O)=O)c(C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: