Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine methyltransferase 3 (PRMT3)
LigandBDBM50427772
Substrate/Competitorn/a
Meas. Tech.ChEMBL_941988
IC50 480±n/a nM
Citation Liu FLi FMa ADobrovetsky EDong AGao CKorboukh ILiu JSmil DBrown PJFrye SVArrowsmith CHSchapira MVedadi MJin J Exploiting an allosteric binding site of PRMT3 yields potent and selective inhibitors. J Med Chem 56:2110-24 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine methyltransferase 3 (PRMT3)
Name:Protein arginine N-methyltransferase 3
Synonyms:Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3 | Protein arginine N-methyltransferase 3 | Protein arginine N-methyltransferase 3 (PRMT3)
Type:Protein
Mol. Mass.:59859.85
Organism:Homo sapiens (Human)
Description:n/a
Residue:531
Sequence:
MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSA
EETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEY
LKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAR
EDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRT
ESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLN
KLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYP
DICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHW
KQTVFLLEKPFSVKAGEALKGKVTVHKSKKDPRSLTVTLTLNNSTQTYGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50427772
n/a
NameBDBM50427772
Synonyms:CHEMBL2325183
TypeSmall organic molecule
Emp. Form.C15H12N4O2S
Mol. Mass.312.346
SMILESO=C(NCC(=O)c1ccccc1)Nc1ccc2nnsc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: