Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-lysine N-methyltransferase SUV39H2 (Suv39H2)
LigandBDBM50427772
Substrate/Competitorn/a
Meas. Tech.ChEMBL_941985
IC50 22000±n/a nM
Citation Liu FLi FMa ADobrovetsky EDong AGao CKorboukh ILiu JSmil DBrown PJFrye SVArrowsmith CHSchapira MVedadi MJin J Exploiting an allosteric binding site of PRMT3 yields potent and selective inhibitors. J Med Chem 56:2110-24 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-lysine N-methyltransferase SUV39H2 (Suv39H2)
Name:Histone-lysine N-methyltransferase SUV39H2 (Suv39H2)
Synonyms:H3-K9-HMTase 2 | Histone H3-K9 methyltransferase 2 | Histone-lysine N-methyltransferase SUV39H2 | Lysine N-methyltransferase 1B | Su(var)3-9 homolog 2 | Suppressor of variegation 3-9 homolog 2
Type:Enzyme
Mol. Mass.:46692.47
Organism:Homo sapiens (Human)
Description:Q9H5I1
Residue:410
Sequence:
MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50427772
n/a
NameBDBM50427772
Synonyms:CHEMBL2325183
TypeSmall organic molecule
Emp. Form.C15H12N4O2S
Mol. Mass.312.346
SMILESO=C(NCC(=O)c1ccccc1)Nc1ccc2nnsc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: