Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 55
LigandBDBM21278
Substrate/Competitorn/a
Meas. Tech.ChEMBL_943908
EC50 2010±n/a nM
Citation Rempel VFuchs AHinz SKarcz TLehr MKoetter UMüller CE Magnolia Extract, Magnolol, and Metabolites: Activation of Cannabinoid CB2 Receptors and Blockade of the Related GPR55. ACS Med Chem Lett 4:41-5 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled receptor 55
Name:G-protein coupled receptor 55
Synonyms:G protein-coupled receptor 55
Type:PROTEIN
Mol. Mass.:36649.72
Organism:Homo sapiens (Human)
Description:ChEMBL_1292265
Residue:319
Sequence:
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF
LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK
VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL
PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
AHRPSRVQLVLQDTTISRG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21278
n/a
NameBDBM21278
Synonyms:5-(4-chlorophenyl)-1-(2,4-dichlorophenyl)-4-methyl-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide | Acomplia | CHEMBL111 | CHEMBL558598 | RIMONABANT HYDROCHLORIDE | Rimonabant | SR 141716A | SR141716 | SR141716A | [3H]Rimonabant | [3H]SR141716A
TypeSmall organic molecule
Emp. Form.C22H21Cl3N4O
Mol. Mass.463.787
SMILESCc1c(nn(c1-c1ccc(Cl)cc1)-c1ccc(Cl)cc1Cl)C(=O)NN1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: