Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM78304
Substrate/Competitorn/a
Meas. Tech.ChEMBL_943917
Ki 1440±n/a nM
Citation Rempel VFuchs AHinz SKarcz TLehr MKoetter UMüller CE Magnolia Extract, Magnolol, and Metabolites: Activation of Cannabinoid CB2 Receptors and Blockade of the Related GPR55. ACS Med Chem Lett 4:41-5 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM78304
n/a
NameBDBM78304
Synonyms:2-(2-hydroxy-5-prop-2-enylphenyl)-4-prop-2-enylphenol | 2-(2-oxidanyl-5-prop-2-enyl-phenyl)-4-prop-2-enyl-phenol | 4-allyl-2-(5-allyl-2-hydroxy-phenyl)phenol | MLS001048917 | SMR000387108 | cid_72300
TypeSmall organic molecule
Emp. Form.C18H18O2
Mol. Mass.266.3343
SMILESOc1ccc(CC=C)cc1-c1cc(CC=C)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: