Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 2, isoform A
LigandBDBM50382706
Substrate/Competitorn/a
Meas. Tech.ChEMBL_942137
Ki 213±n/a nM
Citation Syrjänen LTolvanen MEHilvo MVullo DCarta FSupuran CTParkkila S Characterization, bioinformatic analysis and dithiocarbamate inhibition studies of two newa-carbonic anhydrases, CAH1 and CAH2, from the fruit fly Drosophila melanogaster. Bioorg Med Chem 21:1516-21 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 2, isoform A
Name:Carbonic anhydrase 2, isoform A
Synonyms:CAH2 | Dmel_CG6906 | LD26647p
Type:PROTEIN
Mol. Mass.:37674.24
Organism:Drosophila melanogaster
Description:ChEMBL_942137
Residue:335
Sequence:
MRRCRNTPFAIVIAPILICASLVLAQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVS
AVEKKFPKLEFFNFKVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFE
QFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGD
KSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTW
IDFTTPIDITEKQLNAFRLLTANDDHLKNNFRPIQPLNDRTLYKNYIEIPIHNMGSIPLV
DAENAAGKWRAQAAAVLLPLVVLAALSRTSIFRGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50382706
n/a
NameBDBM50382706
Synonyms:Benzyldithiocarbamate sodium salt (I) | CHEMBL2023168
TypeSmall organic molecule
Emp. Form.C8H8NS2
Mol. Mass.182.286
SMILES[S-]C(=S)NCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: