Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 12
LigandBDBM50428448
Substrate/Competitorn/a
Meas. Tech.ChEMBL_942151
Ki 4770±n/a nM
Citation Tuccinardi TBertini SGranchi COrtore GMacchia MMinutolo FMartinelli ASupuran CT Salicylaldoxime derivatives as new leads for the development of carbonic anhydrase inhibitors. Bioorg Med Chem 21:1511-5 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 12
Name:Carbonic anhydrase
Synonyms:CA-XII | Carbonate dehydratase XII | Carbonic anhydrase 12 (CA XII) | Carbonic anhydrase XII (CA XII) | Carbonic anhydrase XII (CAXII) | Tumor antigen HOM-RCC-3.1.3
Type:Enzyme
Mol. Mass.:39456.00
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:354
Sequence:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50428448
n/a
NameBDBM50428448
Synonyms:CHEMBL479836
TypeSmall organic molecule
Emp. Form.C14H11ClFNO3
Mol. Mass.295.693
SMILESCC(N=O)c1ccc(-c2ccc(O)c(F)c2)c(Cl)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: