Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPERQ amino acid-rich with GYF domain-containing protein 2
LigandBDBM50428560
Substrate/Competitorn/a
Meas. Tech.ChEMBL_944555
Kd 186±n/a nM
Citation Tsukuda SKusayanagi TUmeda EWatanabe CTosaki YTKamisuki STakeuchi TTakakusagi YShiina ISugawara F Ridaifen B, a tamoxifen derivative, directly binds to Grb10 interacting GYF protein 2. Bioorg Med Chem 21:311-20 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PERQ amino acid-rich with GYF domain-containing protein 2
Name:PERQ amino acid-rich with GYF domain-containing protein 2
Synonyms:GIGYF2 | GRB10-interacting GYF protein 2 | KIAA0642 | PERQ2 | TNRC15 | Trinucleotide repeat-containing gene 15 protein
Type:PROTEIN
Mol. Mass.:150045.54
Organism:Homo sapiens (Human)
Description:ChEMBL_944555
Residue:1299
Sequence:
MAAETQTLNFGPEWLRALSSGGSITSPPLSPALPKYKLADYRYGREEMLALFLKDNKIPS
DLLDKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRLTGRGGGGTVVGAPRGR
SSSRGRGRGRGECGFYQRSFDEVEGVFGRGGGREMHRSQSWEERGDRRFEKPGRKDVGRP
NFEEGGPTSVGRKHEFIRSESENWRIFREEQNGEDEDGGWRLAGSRRDGERWRPHSPDGP
RSAGWREHMERRRRFEFDFRDRDDERGYRRVRSGSGSIDDDRDSLPEWCLEDAEEEMGTF
DSSGAFLSLKKVQKEPIPEEQEMDFRPVDEGEECSDSEGSHNEEAKEPDKTNKKEGEKTD
RVGVEASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPA
KVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVST
EPDDEEGLKHLEQQAEKMVAYLQDSALDDERLASKLQEHRAKGVSIPLMHEAMQKWYYKD
PQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPP
HMGELDQERLTRQQELTALYQMQHLQYQQFLIQQQYAQVLAQQQKAALSSQQQQQLALLL
QQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPLDTTTPG
PALEQLQQLEKAKAAKLEQERREAEMRAKREEEERKRQEELRRQQEEILRRQQEEERKRR
EEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELL
RKQEEEAAKWAREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQ
QQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQSQATLSLAEIQKLEEERERQL
REEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQ
QQHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWD
DAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEKLLKLFQGVNKAQDGFTQWCE
QMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKA
NQQRQQQQLPQQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQS
GKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50428560
n/a
NameBDBM50428560
Synonyms:CHEMBL2337520
TypeSmall organic molecule
Emp. Form.C50H67N5O6S
Mol. Mass.866.162
SMILES[#6]-[#6]\[#6](=[#6](/c1ccc(-[#8]-[#6]-[#6]-[#7]-2-[#6]-[#6]-[#6]-[#6]-2)cc1)-c1ccc(-[#8]-[#6]-[#6]-[#7]-2-[#6]-[#6]-[#6]-[#6]-2)cc1)-c1cccc(-[#8]-[#6](=O)-[#6]-[#6]-[#6]-[#6]-[#6]-[#7]-[#6](=O)-[#6]-[#6]-[#6]-[#6]-[#6@@H]-2-[#16]-[#6]-[#6@@H]-3-[#7]-[#6](=O)-[#7]-[#6@H]-2-3)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: