Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor
LigandBDBM50428854
Substrate/Competitorn/a
Meas. Tech.ChEMBL_946080
EC50 150±n/a nM
Citation Taygerly JPMcGee LRRubenstein SMHouze JBCushing TDLi YMotani AChen JLFrankmoelle WYe GLearned MRJaen JMiao STimmermans PBThoolen MKearney PFlygare JBeckmann HWeiszmann JLindstrom MWalker NLiu JBiermann DWang ZHagiwara AIida TAramaki HKitao YShinkai HFurukawa NNishiu JNakamura M Discovery of INT131: a selective PPAR¿ modulator that enhances insulin sensitivity. Bioorg Med Chem 21:979-92 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor
Name:Peroxisome proliferator-activated receptor
Synonyms:Nuclear receptor subfamily 1 group C member 3 | PPAR-gamma | Peroxisome proliferator-activated receptor gamma (PPAR gamma) | Peroxisome proliferator-activated receptor gamma (PPARγ) | Peroxisome proliferator-activated receptor gamma (PPARG) | Peroxisome proliferator-activated receptor gamma/Nuclear receptor corepressor 2 | peroxisome proliferator-activated receptor gamma isoform 2
Type:Nuclear Receptor
Mol. Mass.:57613.46
Organism:Homo sapiens (Human)
Description:n/a
Residue:505
Sequence:
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50428854
n/a
NameBDBM50428854
Synonyms:CHEMBL1236924
TypeSmall organic molecule
Emp. Form.C21H12Cl4N2O3S
Mol. Mass.514.209
SMILESClc1ccc(c(Cl)c1)S(=O)(=O)Nc1cc(Cl)c(Oc2cnc3ccccc3c2)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: