| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50429216 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_945637 (CHEMBL2344971) |
|---|
| Ki | 0.280000±n/a nM |
|---|
| Citation |  Fukaya, T; Kodo, T; Ishiyama, T; Nishikawa, H; Baba, S; Masumoto, S Design, synthesis and structure-activity relationship of novel tricyclic benzimidazolone derivatives as potent 18 kDa translocator protein (TSPO) ligands. Bioorg Med Chem21:1257-67 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50429216 |
|---|
| n/a |
|---|
| Name | BDBM50429216 |
|---|
| Synonyms: | CHEMBL2332259 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H25N3O3 |
|---|
| Mol. Mass. | 427.495 |
|---|
| SMILES | COc1cccc(c1)N(C)C(=O)Cn1c2cc(cc3CCCn(c23)c1=O)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
