Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVascular endothelial growth factor receptor 2
LigandBDBM50429477
Substrate/Competitorn/a
Meas. Tech.ChEMBL_943682
IC50 2250±n/a nM
Citation Yang LLLi GBMa SZou CZhou SSun QZCheng CChen XWang LJFeng SLi LLYang SY Structure-activity relationship studies of pyrazolo[3,4-d]pyrimidine derivatives leading to the discovery of a novel multikinase inhibitor that potently inhibits FLT3 and VEGFR2 and evaluation of its activity against acute myeloid leukemia in vitro and in vivo. J Med Chem 56:1641-55 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vascular endothelial growth factor receptor 2
Name:Vascular endothelial growth factor receptor 2
Synonyms:FLK-1b | Fetal liver kinase 1b | Kinase insert domain receptor | Kinase insert domain receptor-B | Protein-tyrosine kinase receptor flk-1b | VEGFR-2 | VEGFR-2 homolog B | Vascular endothelial growth factor receptor 2 homolog B | flk1b | kdr | kdrb | si:ch211-254j6.1
Type:PROTEIN
Mol. Mass.:153046.15
Organism:Danio rerio
Description:ChEMBL_943682
Residue:1357
Sequence:
MAKTSYALLLLDILLTFNVAKAIELRFVPDPPTLNITEKTIKINASDTLQITCRGRQILE
WSTPHNRTSSETRLTISDCSGDGLFCSTLTLSKAVANETGEYRCFYKSLPKEDGKTSVAV
YVFIQDYRTPFVRIAQDYDVVFIREGEQVVIPCLVSVEDLNVTLYTKYPVKELSTDGKEV
IWDSRRGFILPSRVVSYAGVVYCQTTIRNETFQSSPYIVAVVGYKIYDLTLSPQHERLTV
GERLILNCTAHTELNVGIDFQWTFPHEKRSVNGSMSTSRYKTSSNKKKLWNSLELSNTLT
VENVTLNDTGEYICTASSGQMQKIAQASLIVYEKPFIALSDQLWQTVEAKAGDAEAKILV
KYYAYPEPAVRWYKNDQLIVLRDEYRMKFYRGVHLTIYGVTEKDAGNYTVVMTNKITKEE
QRRTFQLVVNDLPRIFEKDVSLDRDVHMYGSSPTLTCTASGGSSPVTIKWQWMPREDCPV
RFLPKSDTRMAKCDKWREMSNNTGKNPLISQTSVDERTLKTISTLKIQKAVDHALYRCIA
TNKMGQDQRVIVFQVTRFLNLSVLPSSSPIEGQDVIMRCVADRLLYYNLRWYRVANVANH
DPPPAAVPCDTLTLSHLHQPNVTVSGLQGTNVTLDMPIPNATMMDQGLYACQVEIVGTNE
KTCLLHNLRLRALEMSRIVTNLTDQRVNVSDSTTLVCEVSGTPTPTIVWTKDNQTVMEGS
GVILKRSNRVLTIQRVKKEDSGLYICTACNQQGCESSEARISVDGAEEKMNVELIMPIGA
VVIAMFLWLLIVFVIRNRKRPNDGDLKTGYLSIILDSDDMPMDEHCERLTYDASKWEFPR
DRLKLGEPLGRGAFGQVVEATAYGIEKATTCTTVAVKMLKEGATSSEYRALMSELKILIH
IGHHLNVVNLLGACTKQGGPLMVIVEYCKHGNLSSYLKSKRGEYSPYKKRTPRMPNRREV
QQDEDPREGDLGLGTSTRLDICTGTAVCTRTGEQTYKTLQDEQESSDWDHLTMEDLISYS
FQVAKGMEFLASRKCIHRDLAARNILLSENSVVKICDFGLARDVYKDPDYVRKGDARLPL
KWMAPETIFDRVYTTQSDVWSFGVLLWEIFSLGASPYPGVCIDESFCRRLKEGTRMRAPD
YATPEIYQTMLDCWLDRPLDRPTFTQLVEHLGNLLQASAQQDGKDYIPLTNGEMEEELVA
PHLNVTSKRSFYAGNTEAQLHYDNAPPLGFPQQMNSSGVPVNMTGFVDIPLEHTTVMDGH
VDCGVGLSREQMKALDRQAQRPLNFSPLLRCKSKESLASESSNQTSGYQSGYHSDDAEAP
IYANEEMILKRDIRKKPPLPKRNDKFSAEVRYSAPPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429477
n/a
NameBDBM50429477
Synonyms:CHEMBL2332840
TypeSmall organic molecule
Emp. Form.C19H12ClF3N6O2
Mol. Mass.448.786
SMILESFC(F)(F)c1cc(NC(=O)Nc2ccc(Oc3ncnc4n[nH]cc34)cc2)ccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: