Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y14
LigandBDBM50429534
Substrate/Competitorn/a
Meas. Tech.ChEMBL_945218
Ki 3300±n/a nM
Citation Chao HTurdi HHerpin TFRoberge JYLiu YSchnur DMPoss MARehfuss RHua JWu QPrice LAAbell LMSchumacher WABostwick JSSteinbacher TEStewart ABOgletree MLHuang CSChang MCacace AMArcuri MJCelani DWexler RRLawrence RM Discovery of 2-(phenoxypyridine)-3-phenylureas as small molecule P2Y1 antagonists. J Med Chem 56:1704-14 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y14
Name:Purinergic receptor P2Y14
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:38991.62
Organism:Homo sapiens (Human)
Description:ChEMBL_1502487
Residue:338
Sequence:
MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL
KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY
YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG
RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF
VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429534
n/a
NameBDBM50429534
Synonyms:CHEMBL2333773
TypeSmall organic molecule
Emp. Form.C22H20F3N3O3
Mol. Mass.431.4077
SMILESCC(C)c1ccccc1Oc1ncccc1NC(=O)Nc1ccc(OC(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: