Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPyrimidinergic receptor P2Y6
LigandBDBM50429537
Substrate/Competitorn/a
Meas. Tech.ChEMBL_945220
Ki>15000±n/a nM
Citation Chao HTurdi HHerpin TFRoberge JYLiu YSchnur DMPoss MARehfuss RHua JWu QPrice LAAbell LMSchumacher WABostwick JSSteinbacher TEStewart ABOgletree MLHuang CSChang MCacace AMArcuri MJCelani DWexler RRLawrence RM Discovery of 2-(phenoxypyridine)-3-phenylureas as small molecule P2Y1 antagonists. J Med Chem 56:1704-14 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pyrimidinergic receptor P2Y6
Name:Pyrimidinergic receptor P2Y6
Synonyms:P2Y purinoceptor 6 | P2Y6
Type:PROTEIN
Mol. Mass.:36452.29
Organism:Homo sapiens (Human)
Description:ChEMBL_1511151
Residue:328
Sequence:
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429537
n/a
NameBDBM50429537
Synonyms:CHEMBL2333770
TypeSmall organic molecule
Emp. Form.C23H22F3N3O3
Mol. Mass.445.4343
SMILESCC(C)(C)c1ccccc1Oc1ncccc1NC(=O)Nc1ccc(OC(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: