| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 2 |
|---|
| Ligand | BDBM50429534 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_945221 (CHEMBL2339547) |
|---|
| Ki | 6400±n/a nM |
|---|
| Citation |  Chao, H; Turdi, H; Herpin, TF; Roberge, JY; Liu, Y; Schnur, DM; Poss, MA; Rehfuss, R; Hua, J; Wu, Q; Price, LA; Abell, LM; Schumacher, WA; Bostwick, JS; Steinbacher, TE; Stewart, AB; Ogletree, ML; Huang, CS; Chang, M; Cacace, AM; Arcuri, MJ; Celani, D; Wexler, RR; Lawrence, RM Discovery of 2-(phenoxypyridine)-3-phenylureas as small molecule P2Y1 antagonists. J Med Chem56:1704-14 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2Y purinoceptor 2 |
|---|
| Name: | P2Y purinoceptor 2 |
|---|
| Synonyms: | ATP receptor | P2RU1 | P2RY2 | P2RY2_HUMAN | P2U purinoceptor 1 | P2U1 | P2Y purinoceptor 2 | P2Y2 | Purinergic receptor | Purinergic receptor P2Y2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 42299.21 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1455361 |
|---|
| Residue: | 377 |
|---|
| Sequence: | MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
|
|
|
|---|
| BDBM50429534 |
|---|
| n/a |
|---|
| Name | BDBM50429534 |
|---|
| Synonyms: | CHEMBL2333773 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H20F3N3O3 |
|---|
| Mol. Mass. | 431.4077 |
|---|
| SMILES | CC(C)c1ccccc1Oc1ncccc1NC(=O)Nc1ccc(OC(F)(F)F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
