Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y2
LigandBDBM50429538
Substrate/Competitorn/a
Meas. Tech.ChEMBL_945221
Ki 2700±n/a nM
Citation Chao HTurdi HHerpin TFRoberge JYLiu YSchnur DMPoss MARehfuss RHua JWu QPrice LAAbell LMSchumacher WABostwick JSSteinbacher TEStewart ABOgletree MLHuang CSChang MCacace AMArcuri MJCelani DWexler RRLawrence RM Discovery of 2-(phenoxypyridine)-3-phenylureas as small molecule P2Y1 antagonists. J Med Chem 56:1704-14 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y2
Name:Purinergic receptor P2Y2
Synonyms:ATP receptor | P2U purinoceptor 1 | P2U1 | P2Y purinoceptor 2 | P2Y2 | Purinergic receptor
Type:PROTEIN
Mol. Mass.:42299.21
Organism:Homo sapiens (Human)
Description:ChEMBL_1455361
Residue:377
Sequence:
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429538
n/a
NameBDBM50429538
Synonyms:CHEMBL2333767
TypeSmall organic molecule
Emp. Form.C23H25N3OS
Mol. Mass.391.529
SMILESCc1ccc(NC(=O)Nc2cccnc2Sc2ccccc2C(C)(C)C)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: