Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSterol O-acyltransferase 2
LigandBDBM50429574
Substrate/Competitorn/a
Meas. Tech.ChEMBL_945256
IC50 6.3±n/a nM
Citation Ohtawa MYamazaki HOhte SMatsuda DOhshiro TRudel LLOmura STomoda HNagamitsu T Synthesis and structure-activity relationship of pyripyropene A derivatives as potent and selective acyl-CoA:cholesterol acyltransferase 2 (ACAT2) inhibitors: part 1. Bioorg Med Chem Lett 23:1285-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sterol O-acyltransferase 2
Name:Sterol O-acyltransferase 2
Synonyms:ACAT-2 | Acetyl-CoA acetyltransferase, cytosolic | Acetyl-CoA transferase-like protein | Acyl coenzyme A:cholesterol acyltransferase 2 | Cholesterol acyltransferase 2 | Cytosolic acetoacetyl-CoA thiolase | SOAT2
Type:Enzyme
Mol. Mass.:59912.75
Organism:Homo sapiens (Human)
Description:O75908
Residue:522
Sequence:
MEPGGARLRLQRTEGLGGERERQPCGDGNTETHRAPDLVQWTRHMEAVKAQLLEQAQGQL
RELLDRAMREAIQSYPSQDKPLPPPPPGSLSRTQEPSLGKQKVFIIRKSLLDELMEVQHF
RTIYHMFIAGLCVFIISTLAIDFIDEGRLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLA
PYQALRLWARGTWTQATGLGCALLAAHAVVLCALPVHVAVEHQLPPASRCVLVFEQVRFL
MKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYFLFCPTLIYRETYPRTPYVRWNYVAKN
FAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFMLLLIFFAFLH
CWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLRLLGARARG
VAMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIGGMLNFMMHDQRTGPAWNVLMWTM
LFLGQGIQVSLYCQEWYARRHCPLPQATFWGLVTPRSWSCHT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429574
n/a
NameBDBM50429574
Synonyms:CHEMBL2334215
TypeSmall organic molecule
Emp. Form.C37H40FNO10
Mol. Mass.677.7126
SMILESCC(=O)OC[C@]1(C)[C@H](CC[C@@]2(C)[C@H]1C[C@H](OC(=O)c1ccc(C)c(F)c1)[C@@]1(C)Oc3cc(oc(=O)c3[C@H](O)[C@H]21)-c1cccnc1)OC(C)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: