| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein S100-B |
|---|
| Ligand | BDBM34166 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_947124 (CHEMBL2341094) |
|---|
| IC50 | 2000±n/a nM |
|---|
| Citation |  Yoshimura, C; Miyafusa, T; Tsumoto, K Identification of small-molecule inhibitors of the human S100B-p53 interaction and evaluation of their activity in human melanoma cells. Bioorg Med Chem21:1109-15 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein S100-B |
|---|
| Name: | Protein S100-B |
|---|
| Synonyms: | S-100 protein beta chain | S100B | S100B_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10701.34 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_947124 |
|---|
| Residue: | 92 |
|---|
| Sequence: | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
|
|
|
|---|
| BDBM34166 |
|---|
| n/a |
|---|
| Name | BDBM34166 |
|---|
| Synonyms: | (2,4-dipiperidinophenyl)amine | 2,4-Di-piperidin-1-yl-phenylamine | 2,4-bis(1-piperidinyl)aniline | 2,4-di(piperidin-1-yl)aniline | MLS000033228 | SMR000012925 | cid_655480 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H25N3 |
|---|
| Mol. Mass. | 259.3898 |
|---|
| SMILES | Nc1ccc(cc1N1CCCCC1)N1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
