Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
LigandBDBM50104963
Substrate/Competitorn/a
Meas. Tech.ChEMBL_948657
IC50 3±n/a nM
Citation Nuti ESantamaria SCasalini FYamamoto KMarinelli LLa Pietra VNovellino EOrlandini ENencetti SMarini AMSalerno STaliani SDa Settimo FNagase HRossello A Arylsulfonamide inhibitors of aggrecanases as potential therapeutic agents for osteoarthritis: synthesis and biological evaluation. Eur J Med Chem 62:379-94 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Name:A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Synonyms:Aggrecanase-1 | Metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Type:Enzyme
Mol. Mass.:90214.54
Organism:Homo sapiens (Human)
Description:O75173
Residue:837
Sequence:
MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEE
IVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLG
GAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHI
LRRKSPASGQGPMCNVKAPLGSPSPRPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGV
QFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHA
GCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYNNVVTIPAGATHILVRQQGNP
GHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQP
LTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50104963
n/a
NameBDBM50104963
Synonyms:(2S,3R)-2-(cyclopropylmethylamino)-N1-hydroxy-N4-((1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl)-3-(3-hydroxybenzyl)succinamide | (3R)-N~2~-(cyclopropylmethyl)-N~1~-hydroxy-3-(3-hydroxybenzyl)-N~4~-[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]-L-aspartamide | (R)-2-(Cyclopropylmethyl-amino)-N*1*-hydroxy-3-(3-hydroxy-benzyl)-N*4*-((3S,3aR)-2-hydroxy-indan-1-yl)-succinamide | 2-(Cyclopropylmethyl-amino)-N*1*-hydroxy-3-(3-hydroxy-benzyl)-N*4*-(2-hydroxy-indan-1-yl)-succinamide | CHEMBL24398
TypeSmall organic molecule
Emp. Form.C24H29N3O5
Mol. Mass.439.5042
SMILESONC(=O)[C@@H](NCC1CC1)[C@@H](Cc1cccc(O)c1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: