Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50429824
Substrate/Competitorn/a
Meas. Tech.ChEMBL_949080
EC50>10000±n/a nM
Citation Nettekoven MFingerle JGrether UGrüner SKimbara APüllmann BRogers-Evans MRöver SSchuler FSchulz-Gasch TUllmer C Highly potent and selective cannabinoid receptor 2 agonists: initial hit optimization of an adamantyl hit series identified from high-through-put screening. Bioorg Med Chem Lett 23:1177-81 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:Brain-type cannabinoid receptor | CANNABINOID CB1 | CB-R | CB1 | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor
Type:Enzyme
Mol. Mass.:52842.52
Organism:Mus musculus (Mouse)
Description:P47746
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429824
n/a
NameBDBM50429824
Synonyms:CHEMBL2338188
TypeSmall organic molecule
Emp. Form.C19H23NO
Mol. Mass.281.392
SMILESO=C(C1C2CC3CC(C2)CC1C3)N1CCc2ccccc12 |TLB:8:7:11:4.3.2,8:3:6.7.9:11,THB:2:3:6:9.10.11,2:10:6:4.8.3,1:2:6.7.9:11,(54.97,-16.45,;54.99,-18,;53.66,-18.79,;53.65,-20.32,;52.25,-20.67,;50.91,-20.18,;49.71,-21.46,;51.22,-21.04,;52.63,-21.61,;51.22,-19.45,;52.26,-18.21,;50.91,-18.69,;56.34,-18.76,;56.52,-20.29,;58.04,-20.59,;58.79,-19.24,;60.29,-18.91,;60.75,-17.44,;59.69,-16.3,;58.2,-16.64,;57.75,-18.11,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: