Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50429838
Substrate/Competitorn/a
Meas. Tech.ChEMBL_949086
EC50 2600±n/a nM
Citation Nettekoven MFingerle JGrether UGrüner SKimbara APüllmann BRogers-Evans MRöver SSchuler FSchulz-Gasch TUllmer C Highly potent and selective cannabinoid receptor 2 agonists: initial hit optimization of an adamantyl hit series identified from high-through-put screening. Bioorg Med Chem Lett 23:1177-81 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429838
n/a
NameBDBM50429838
Synonyms:CHEMBL2338189
TypeSmall organic molecule
Emp. Form.C19H23NO2
Mol. Mass.297.3914
SMILESOC12CC3CC(C1)CC(C3)(C2)C(=O)N1CCc2ccccc12 |TLB:9:8:4.3.2:6,0:1:4:7.9.8,11:8:4:2.1.6,THB:9:3:6:7.8.10,10:8:4:2.1.6,10:1:4:7.9.8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: