Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 13 (CA XIII)
LigandBDBM50429908
Substrate/Competitorn/a
Meas. Tech.ChEMBL_945277
pH7±n/a
Kd 0.250000±n/a nM
Commentsextracted
Citation Dudutiene VZubriene ASmirnov AGylyte JTimm DManakova EGražulis SMatulis D 4-Substituted-2,3,5,6-tetrafluorobenzenesulfonamides as inhibitors of carbonic anhydrases I, II, VII, XII, and XIII. Bioorg Med Chem 21:2093-106 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 13 (CA XIII)
Name:Carbonic anhydrase 13 (CA XIII)
Synonyms:Carbonic anhydrase XIII (CA XIII)
Type:Enzyme
Mol. Mass.:29445.78
Organism:Homo sapiens (Human)
Description:Q8N1Q1
Residue:262
Sequence:
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50429908
n/a
NameBDBM50429908
Synonyms:CHEMBL2333411
TypeSmall organic molecule
Emp. Form.C13H6F4N2O2S3
Mol. Mass.394.388
SMILESNS(=O)(=O)c1c(F)c(F)c(Sc2nc3ccccc3s2)c(F)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: