Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetα-glucosidase
LigandBDBM50341204
Substrate/Competitorn/a
Meas. Tech.ChEMBL_947690
Ki 4860±n/a nM
Citation Mata RCristians SEscandón-Rivera SJuárez-Reyes KRivero-Cruz I Mexican antidiabetic herbs: valuable sources of inhibitors ofa-glucosidases. J Nat Prod 76:468-83 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
α-glucosidase
Name:α-glucosidase
Synonyms:Alpha-glucosidase | Alpha-glucosidase (α-glucosidase) | Oligo-1,6-glucosidase
Type:Protein
Mol. Mass.:68577.59
Organism:Saccharomyces cerevisiae S288c (Baker's yeast)
Description:n/a
Residue:589
Sequence:
MTISSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQS
SDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSEL
FNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIK
EEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGIN
VEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAA
LNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50341204
n/a
NameBDBM50341204
Synonyms:(Z)-3-butylidenephthalide | CHEMBL1765390
TypeSmall organic molecule
Emp. Form.C12H12O2
Mol. Mass.188.2225
SMILESCCC\C=C1\OC(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: