| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member C4 |
|---|
| Ligand | BDBM22971 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_942524 (CHEMBL2346179) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Heinrich, DM; Flanagan, JU; Jamieson, SM; Silva, S; Rigoreau, LJ; Trivier, E; Raynham, T; Turnbull, AP; Denny, WA Synthesis and structure-activity relationships for 1-(4-(piperidin-1-ylsulfonyl)phenyl)pyrrolidin-2-ones as novel non-carboxylate inhibitors of the aldo-keto reductase enzyme AKR1C3. Eur J Med Chem62:738-44 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member C4 |
|---|
| Name: | Aldo-keto reductase family 1 member C4 |
|---|
| Synonyms: | 3-alpha-HSD1 | 3-alpha-Hydroxysteroid Dehydrogenase Type 1 (AKR1C4) | 3-alpha-hydroxysteroid dehydrogenase type I | AK1C4_HUMAN | AKR1C4 | Aldo-keto reductase family 1 member C4 | Aldo-keto reductase family 1 member C4 (AK1C4) | CDR | CHDR | Chlordecone reductase | DD-4 | DD4 | Dihydrodiol dehydrogenase 4 | HAKRA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37068.40 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P17516 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPM
ALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKP
GLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPV
LCALAKKHKQTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLN
RNYRYVVMDFLMDHPDYPFSDEY
|
|
|
|---|
| BDBM22971 |
|---|
| n/a |
|---|
| Name | BDBM22971 |
|---|
| Synonyms: | 2-[(2,6-dichloro-3-methylphenyl)amino]benzoic acid | CHEMBL509 | Meclofenamate | Meclofenamic acid | US11337935, Compound Meclofenamic-acid | US20240002326, Compound Meclofenamic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11Cl2NO2 |
|---|
| Mol. Mass. | 296.149 |
|---|
| SMILES | Cc1ccc(Cl)c(Nc2ccccc2C(O)=O)c1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
