Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-amino-acid oxidase
LigandBDBM31148
Substrate/Competitorn/a
Meas. Tech.ChEMBL_947859
IC50 6.9±n/a nM
Citation Hondo TWarizaya MNiimi TNamatame IYamaguchi TNakanishi KHamajima THarada KSakashita HMatsumoto YOrita MTakeuchi M 4-Hydroxypyridazin-3(2H)-one derivatives as novel D-amino acid oxidase inhibitors. J Med Chem 56:3582-92 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D-amino-acid oxidase
Name:D-amino-acid oxidase
Synonyms:D-amino-acid oxidase (DAAO) | DAAO | DAMOX | DAO
Type:Homodimer
Mol. Mass.:39476.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:347
Sequence:
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31148
n/a
NameBDBM31148
Synonyms:3-hydroxyquinolin-2(1H)-one, 2 | US9701638, 1
TypeSmall organic molecule
Emp. Form.C9H7NO2
Mol. Mass.161.1574
SMILESOc1cc2ccccc2[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: