Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNAD-Dependent Deacetylase Sirtuin-1
LigandBDBM50431094
Substrate/Competitorn/a
Meas. Tech.ChEMBL_948318
IC50 120±n/a nM
Citation Disch JSEvindar GChiu CHBlum CADai HJin LSchuman ELind KEBelyanskaya SLDeng JCoppo FAquilani LGraybill TLCuozzo JWLavu SMao CVlasuk GPPerni RB Discovery of thieno[3,2-d]pyrimidine-6-carboxamides as potent inhibitors of SIRT1, SIRT2, and SIRT3. J Med Chem 56:3666-79 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NAD-Dependent Deacetylase Sirtuin-1
Name:NAD-dependent deacetylase sirtuin 1
Synonyms:NAD-dependent deacetylase sirtuin 1 | NAD-dependent protein deacetylase sirtuin-1 (SIRT1) | SIR2-like protein 1 | SIRT1 | Sirtuin 1 (SIRT1) | Sirtuin-1 (SIRT1) | hSIR2
Type:Developmental protein; hydrolase
Mol. Mass.:81626.66
Organism:Homo sapiens (Human)
Description:n/a
Residue:747
Sequence:
MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
GDDQEAINEAISVKQEVTDMNYPSNKS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431094
n/a
NameBDBM50431094
Synonyms:CHEMBL2338809
TypeSmall organic molecule
Emp. Form.C18H26N6O2S
Mol. Mass.390.503
SMILESCC(C)(C)C(=O)NCCN1CCN(CC1)c1ncnc2cc(sc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: