Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNAD-dependent protein deacetylase sirtuin-3 (SIRT3)
LigandBDBM50431121
Substrate/Competitorn/a
Meas. Tech.ChEMBL_948316
IC50 4.9±n/a nM
Citation Disch JSEvindar GChiu CHBlum CADai HJin LSchuman ELind KEBelyanskaya SLDeng JCoppo FAquilani LGraybill TLCuozzo JWLavu SMao CVlasuk GPPerni RB Discovery of thieno[3,2-d]pyrimidine-6-carboxamides as potent inhibitors of SIRT1, SIRT2, and SIRT3. J Med Chem 56:3666-79 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NAD-dependent protein deacetylase sirtuin-3 (SIRT3)
Name:NAD-dependent deacetylase sirtuin 3
Synonyms:NAD-dependent deacetylase sirtuin 3
Type:Protein
Mol. Mass.:43582.69
Organism:Homo sapiens (Human)
Description:Q9NTG7
Residue:399
Sequence:
MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEP
LDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDK
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIF
ELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIP
ASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQ
RFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431121
n/a
NameBDBM50431121
Synonyms:CHEMBL2332037
TypeSmall organic molecule
Emp. Form.C24H28N6O3S
Mol. Mass.480.583
SMILESCCNC(=O)c1cccc(c1)C(=O)NCCC1CCN(CC1)c1ncnc2cc(sc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: