Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNAD-dependent deacetylase sirtuin 2
LigandBDBM50431095
Substrate/Competitorn/a
Meas. Tech.ChEMBL_948317
IC50 16±n/a nM
Citation Disch JSEvindar GChiu CHBlum CADai HJin LSchuman ELind KEBelyanskaya SLDeng JCoppo FAquilani LGraybill TLCuozzo JWLavu SMao CVlasuk GPPerni RB Discovery of thieno[3,2-d]pyrimidine-6-carboxamides as potent inhibitors of SIRT1, SIRT2, and SIRT3. J Med Chem 56:3666-79 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NAD-dependent deacetylase sirtuin 2
Name:NAD-dependent deacetylase sirtuin 2
Synonyms:NAD-Dependent Deacetylase Sirtuin-2 | NAD-dependent deacetylase sirtuin 3 | NAD-dependent protein deacetylase sirtuin-2 (SIRT2) | SIR2-like | SIR2-like protein 2 | SIRT2 | Sirtuin 2 (SIRT2)
Type:Hydrolase
Mol. Mass.:43172.62
Organism:Homo sapiens (Human)
Description:n/a
Residue:389
Sequence:
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431095
n/a
NameBDBM50431095
Synonyms:CHEMBL2338808
TypeSmall organic molecule
Emp. Form.C20H29N5O2S
Mol. Mass.403.542
SMILESCC(C)(C)C(=O)NCCCC1CCN(CC1)c1ncnc2cc(sc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: