Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase SYK
LigandBDBM50431370
Substrate/Competitorn/a
Meas. Tech.ChEMBL_949757
IC50 5.0±n/a nM
Citation Padilla FBhagirath NChen SChiao EGoldstein DMHermann JCHsu JKennedy-Smith JJKuglstatter ALiao CLiu WLowrie LELuk KCLynch SMMenke JNiu LOwens TDO-Yang CRailkar ASchoenfeld RCSlade MSteiner STan YCVillaseñor AGWang CWanner JXie WXu DZhang XZhou MLucas MC Pyrrolopyrazines as selective spleen tyrosine kinase inhibitors. J Med Chem 56:1677-92 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase SYK
Name:Tyrosine-protein kinase SYK
Synonyms:Lysyl-tRNA synthetase | SYK | Spleen Tyrosine Kinase | Spleen tyrosine kinase (SYK) | Tyrosine-protein kinase SYK (Syk)
Type:Enzyme
Mol. Mass.:72079.99
Organism:Homo sapiens (Human)
Description:P43405
Residue:635
Sequence:
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431370
n/a
NameBDBM50431370
Synonyms:CHEMBL2347991
TypeSmall organic molecule
Emp. Form.C22H25FN6O3
Mol. Mass.440.4707
SMILESCC(C)(C)NC(=O)c1c[nH]c2ncc(nc12)-c1nn(CCC(O)CO)c2cc(F)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: