| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proliferating cell nuclear antigen |
|---|
| Ligand | BDBM18860 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_952429 (CHEMBL2352795) |
|---|
| IC50 | 3600±n/a nM |
|---|
| Citation |  Actis, M; Inoue, A; Evison, B; Perry, S; Punchihewa, C; Fujii, N Small molecule inhibitors of PCNA/PIP-box interaction suppress translesion DNA synthesis. Bioorg Med Chem21:1972-7 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proliferating cell nuclear antigen |
|---|
| Name: | Proliferating cell nuclear antigen |
|---|
| Synonyms: | Cyclin | PCNA | PCNA_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28752.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_952429 |
|---|
| Residue: | 261 |
|---|
| Sequence: | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
|
|
|
|---|
| BDBM18860 |
|---|
| n/a |
|---|
| Name | BDBM18860 |
|---|
| Synonyms: | (2R)-2-amino-3-[4-(4-hydroxy-3-iodophenoxy)-3,5-diiodophenyl]propanoic acid | (2S)-2-amino-3-[4-(4-hydroxy-3-iodophenoxy)-3,5-diiodophenyl]propanoic acid | 3,5,3'-triiodo-L-thyronine (T3) | CHEMBL1544 | Triiodothyronine | Triiodothyronine (T3) | US10544075, Compound T3 | [125I]T3 | liothyronine | triothyrone |
|---|
| Type | Hormone |
|---|
| Emp. Form. | C15H12I3NO4 |
|---|
| Mol. Mass. | 650.9735 |
|---|
| SMILES | N[C@@H](Cc1cc(I)c(Oc2ccc(O)c(I)c2)c(I)c1)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
