Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein arginine methyltransferase 3 (PRMT3)
LigandBDBM50431676
Substrate/Competitorn/a
Meas. Tech.ChEMBL_951489
Ki 1150±n/a nM
Citation Yu WSmil DLi FTempel WFedorov ONguyen KTBolshan YAl-Awar RKnapp SArrowsmith CHVedadi MBrown PJSchapira M Bromo-deaza-SAH: a potent and selective DOT1L inhibitor. Bioorg Med Chem 21:1787-94 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein arginine methyltransferase 3 (PRMT3)
Name:Protein arginine N-methyltransferase 3
Synonyms:Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3 | Protein arginine N-methyltransferase 3 | Protein arginine N-methyltransferase 3 (PRMT3)
Type:Protein
Mol. Mass.:59859.85
Organism:Homo sapiens (Human)
Description:n/a
Residue:531
Sequence:
MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSA
EETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEY
LKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAR
EDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRT
ESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLN
KLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYP
DICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHW
KQTVFLLEKPFSVKAGEALKGKVTVHKSKKDPRSLTVTLTLNNSTQTYGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50431676
n/a
NameBDBM50431676
Synonyms:CHEMBL2349526
TypeSmall organic molecule
Emp. Form.C15H20BrN5O5S
Mol. Mass.462.319
SMILESN[C@@H](CCSC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cc(Br)c2c(N)ncnc12)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: