Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-acyl carrier reductase
LigandBDBM8726
Substrate/Competitorn/a
Meas. Tech.ChEMBL_953658
IC50 15±n/a nM
Citation Cheng GMuench SPZhou YAfanador GAMui EJFomovska ALai BSPrigge STWoods SRoberts CWHickman MRLee PJLeed SEAuschwitz JMRice DWMcLeod R Design, synthesis, and biological activity of diaryl ether inhibitors of Toxoplasma gondii enoyl reductase. Bioorg Med Chem Lett 23:2035-43 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Enoyl-acyl carrier reductase
Name:Enoyl-acyl carrier reductase
Synonyms:Enoyl-acyl carrier reductase (ENR) | Enoyl-acyl carrier reductase, putative
Type:PROTEIN
Mol. Mass.:43663.67
Organism:Toxoplasma gondii
Description:ChEMBL_1290812
Residue:417
Sequence:
MVGFKLLTLGAFVAGELTLVGPAGTMAFTVPNATGAKPLVTSVSVRPSWSSARQNAFSSS
SSRSQSSVRPHSAFVTNRLETAGETGTQHRAADSAAGVGAAQSAFPIDLRGQTAFVAGVA
DSHGYGWAIAKHLASAGARVALGTWPPVLGLFQKSLQSGRLDEDRKLPDGSLIEFAGVYP
LDAAFDKPEDVPQDIKDNKRYAGVDGYTIKEVAVKVKQDLGNIDILVHSLANGPEVTKPL
LETSRKGYLAASSNSAYSFVSLLQHFGPIMNEGGSAVTLSYLAAERVVPGYGGGMSSAKA
ALESDTRTLAWEAGQKYGVRVNAISAGPLKSRAASAIGKSGEKSFIDYAIDYSYNNAPLR
RDLHSDDVGGAALFLLSPLARAVSGVTLYVDNGLHAMGQAVDSRSMPPLQRATQEIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8726
n/a
NameBDBM8726
Synonyms:5-chloro-2-(2,4-dichlorophenoxy)phenol | CHEMBL849 | TCL | Triclosan
TypeSmall organic molecule
Emp. Form.C12H7Cl3O2
Mol. Mass.289.542
SMILESOc1cc(Cl)ccc1Oc1ccc(Cl)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: