Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArginase-2, mitochondrial
LigandBDBM50350309
Substrate/Competitorn/a
Meas. Tech.ChEMBL_954165
IC50 5070±n/a nM
Citation Golebiowski APaul Beckett RVan Zandt MJi MKWhitehouse DRyder TRJagdmann EAndreoli MMazur APadmanilayam MCousido-Siah AMitschler ARuiz FXPodjarny ASchroeter H 2-Substituted-2-amino-6-boronohexanoic acids as arginase inhibitors. Bioorg Med Chem Lett 23:2027-30 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arginase-2, mitochondrial
Name:Arginase-2, mitochondrial
Synonyms:ARG2 | Arginase II | Kidney-type arginase | Non-hepatic arginase | Type II arginase
Type:PROTEIN
Mol. Mass.:38576.93
Organism:Homo sapiens (Human)
Description:ChEMBL_978892
Residue:354
Sequence:
MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50350309
n/a
NameBDBM50350309
Synonyms:CHEMBL1812662
TypeSmall organic molecule
Emp. Form.C7H16BNO4
Mol. Mass.189.017
SMILESCC([NH3+])(CCCCB(O)O)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: