Reaction Details |
| Report a problem with these data |
Target | Casein kinase I isoform alpha |
---|
Ligand | BDBM50432013 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_954191 (CHEMBL2351706) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Elagawany, M; Ibrahim, MA; Ali Ahmed, HE; El-Etrawy, ASh; Ghiaty, A; Abdel-Samii, ZK; El-Feky, SA; Bajorath, J Design, synthesis, and molecular modelling of pyridazinone and phthalazinone derivatives as protein kinases inhibitors. Bioorg Med Chem Lett23:2007-13 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Casein kinase I isoform alpha |
---|
Name: | Casein kinase I isoform alpha |
Synonyms: | CK1 | CKI-alpha | CSNK1A1 | KC1A_PIG |
Type: | PROTEIN |
Mol. Mass.: | 14639.55 |
Organism: | Sus scrofa |
Description: | ChEMBL_939731 |
Residue: | 125 |
Sequence: | GEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLED
LFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFG
LAKKY
|
|
|
BDBM50432013 |
---|
n/a |
---|
Name | BDBM50432013 |
Synonyms: | CHEMBL2348730 |
Type | Small organic molecule |
Emp. Form. | C15H20N4O |
Mol. Mass. | 272.3455 |
SMILES | O=c1[nH]nc(NCCN2CCCCC2)c2ccccc12 |
Structure |
|