Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium-sensing receptor (CaSR)
LigandBDBM50432149
Substrate/Competitorn/a
Meas. Tech.ChEMBL_950625
EC50 10000±n/a nM
Citation Temal TJary HAuberval MLively SGuédin DVevert JPDeprez P New potent calcimimetics: I. Discovery of a series of novel trisubstituted ureas. Bioorg Med Chem Lett 23:2451-4 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcium-sensing receptor (CaSR)
Name:Calcium-sensing receptor (CaSR)
Synonyms:CaSR | Calcium sensing receptor | PCaR1 | Parathyroid Cell calcium-sensing receptor
Type:Protein
Mol. Mass.:120663.13
Organism:Homo sapiens (Human)
Description:P41180
Residue:1078
Sequence:
MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWA
SSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHL
QEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNV
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFS
NCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIA
KEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSLMALGFLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSS
SLGGSTGSTPSSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTLPQQQRSQQQP
RCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGE
TDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGGGSTVTENVVNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50432149
n/a
NameBDBM50432149
Synonyms:CHEMBL2346785
TypeSmall organic molecule
Emp. Form.C32H38N2O3
Mol. Mass.498.6557
SMILESCOC(=O)c1cccc(NC(=O)N(CCC(c2ccccc2)c2ccccc2)CCC2CCCCC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: