Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 2 |
---|
Ligand | BDBM50432469 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_953473 (CHEMBL2351084) |
---|
Ki | 920±n/a nM |
---|
Citation | Karlström, S; Nordvall, G; Sohn, D; Hettman, A; Turek, D; Åhlin, K; Kers, A; Claesson, M; Slivo, C; Lo-Alfredsson, Y; Petersson, C; Bessidskaia, G; Svensson, PH; Rein, T; Jerning, E; Malmberg, Å; Ahlgen, C; Ray, C; Vares, L; Ivanov, V; Johansson, R Substituted 7-amino-5-thio-thiazolo[4,5-d]pyrimidines as potent and selective antagonists of the fractalkine receptor (CX3CR1). J Med Chem56:3177-90 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 2 |
---|
Name: | C-X-C chemokine receptor type 2 |
Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
Type: | Protein |
Mol. Mass.: | 40767.88 |
Organism: | Homo sapiens (Human) |
Description: | P25025 |
Residue: | 360 |
Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
BDBM50432469 |
---|
n/a |
---|
Name | BDBM50432469 |
Synonyms: | CHEMBL2349318 |
Type | Small organic molecule |
Emp. Form. | C19H21N5O2S2 |
Mol. Mass. | 415.532 |
SMILES | CCC[C@H](CO)Nc1nc(S[C@@H](C)c2cccc(c2)C#N)[nH]c2nc(=O)sc12 |r| |
Structure |
|