Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50169951
Substrate/Competitorn/a
Meas. Tech.ChEMBL_952584
Ki 52±n/a nM
Citation Thakur GABajaj SParonis CPeng YBowman ALBarak LSCaron MGParrish DDeschamps JRMakriyannis A Novel adamantyl cannabinoids as CB1 receptor probes. J Med Chem 56:3904-21 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | mCB2
Type:Enzyme Catalytic Domain
Mol. Mass.:38220.43
Organism:MOUSE
Description:P47936
Residue:347
Sequence:
MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILS
SRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLD
VRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYA
LRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169951
n/a
NameBDBM50169951
Synonyms:(6aR,10aR)-3-Adamantan-1-yl-6,6,9-trimethyl-6a,7,10,10a-tetrahydro-6H-benzo[c]chromen-1-ol | (6aR-trans)-3-Adamantan-1-yl-6,6,9-trimethyl-6a,7,10,10a-tetrahydro-6H-benzo[c]chromen-1-ol | AM-411 | CHEMBL434351
TypeSmall organic molecule
Emp. Form.C26H34O2
Mol. Mass.378.547
SMILESCC1=CC[C@@H]2[C@@H](C1)c1c(O)cc(cc1OC2(C)C)C12CC3CC(CC(C3)C1)C2 |r,t:1,TLB:11:18:21.20.25:23,THB:19:20:23:27.18.26,19:18:21.20.25:23,11:18:21:25.24.23,26:18:21:25.24.23,26:24:21:27.19.18|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: