Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetbeta-Carbonic Anhydrase
LigandBDBM50428615
Substrate/Competitorn/a
Meas. Tech.ChEMBL_955915
Ki 134±n/a nM
Citation Vullo DLeewattanapasuk WMühlschlegel FAMastrolorenzo ACapasso CSupuran CT Carbonic anhydrase inhibitors: inhibition of theß-class enzyme from the pathogenic yeast Candida glabrata with sulfonamides, sulfamates and sulfamides. Bioorg Med Chem Lett 23:2647-52 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
beta-Carbonic Anhydrase
Name:beta-Carbonic Anhydrase
Synonyms:NCE103
Type:Enzyme
Mol. Mass.:31587.59
Organism:Candida albicans (Yeast)
Description:n/a
Residue:281
Sequence:
MGRENILKYQLEHDHESDLVTEKDQSLLLDNNNNLNGMNNTIKTHPVRVSSGNHNNFPFT
LSSESTLQDFLNNNKFFVDSIKHNHGNQIFDLNGQGQSPHTLWIGCSDSRAGDQCLATLP
GEIFVHRNIANIVNANDISSQGVIQFAIDVLKVKKIIVCGHTDCGGIWASLSKKKIGGVL
DLWLNPVRHIRAANLKLLEEYNQDPKLKAKKLAELNVISSVTALKRHPSASVALKKNEIE
VWGMLYDVATGYLSQVEIPQDEFEDLFHVHDEHDEEEYNPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50428615
n/a
NameBDBM50428615
Synonyms:CHEMBL2331759
TypeSmall organic molecule
Emp. Form.C13H20N4O3S
Mol. Mass.312.388
SMILESNS(=O)(=O)Nc1ccc(NC(=O)NC2CCCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: