| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM50387134 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_955915 (CHEMBL2379884) |
|---|
| Ki | 84±n/a nM |
|---|
| Citation |  Vullo, D; Leewattanapasuk, W; Mühlschlegel, FA; Mastrolorenzo, A; Capasso, C; Supuran, CT Carbonic anhydrase inhibitors: inhibition of the฿-class enzyme from the pathogenic yeast Candida glabrata with sulfonamides, sulfamates and sulfamides. Bioorg Med Chem Lett23:2647-52 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | CAN_CANAL | NCE103 | beta-Carbonic Anhydrase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 31587.59 |
|---|
| Organism: | Candida albicans (Yeast) |
|---|
| Description: | n/a |
|---|
| Residue: | 281 |
|---|
| Sequence: | MGRENILKYQLEHDHESDLVTEKDQSLLLDNNNNLNGMNNTIKTHPVRVSSGNHNNFPFT
LSSESTLQDFLNNNKFFVDSIKHNHGNQIFDLNGQGQSPHTLWIGCSDSRAGDQCLATLP
GEIFVHRNIANIVNANDISSQGVIQFAIDVLKVKKIIVCGHTDCGGIWASLSKKKIGGVL
DLWLNPVRHIRAANLKLLEEYNQDPKLKAKKLAELNVISSVTALKRHPSASVALKKNEIE
VWGMLYDVATGYLSQVEIPQDEFEDLFHVHDEHDEEEYNPH
|
|
|
|---|
| BDBM50387134 |
|---|
| n/a |
|---|
| Name | BDBM50387134 |
|---|
| Synonyms: | 4-ureidophenyl sulfamate ring derivative 3s | CHEMBL2047814 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H10BrF2N3O4S |
|---|
| Mol. Mass. | 422.202 |
|---|
| SMILES | NS(=O)(=O)Oc1ccc(NC(=O)Nc2c(F)cc(F)cc2Br)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
